HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAD3

Names and origin
Entry : E1XAD3 (unreviewed)
Entry name : E1XAD3_HAEI1
Protein names : ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : atpG
ORF names : HIB_06090
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1); proton-transporting ATPase activity, rota
GO identifier : GO:0005524; GO:0005886; GO:0042777; GO:0046933; GO:0045261; GO:0046961
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase gamma chain family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 309 residues
>E1XAD3|E1XAD3_HAEI1 Haemophilus influenzae 10810
MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKAS
IGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTILNQIKNWKEQNISTDLGLIGS
KGISFFRSFGFNIKGQLSGLGDTPALEELIGVANTMFDAYRNGEIDAIYIAYNKFVNTMS
QKPVVQQLVPLPESKDDHLNERQQTWDYLYEPEPKVLLDSLLVRYLESQIYQAVVDNLAS
EQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGAAAI