HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAC9

Names and origin
Entry : E1XAC9 (unreviewed)
Entry name : E1XAC9_HAEI1
Protein names : Fused phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_06050
History
Date of creation : 2010-11-30
Date of modification : 2013-11-13
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; histidine biosynthetic process; phosphoribosyl-AMP cyclohydrolase activity; phosphoribosyl-ATP diphosphatase activity
GO identifier : GO:0005524; GO:0005737; GO:0000105; GO:0004635; GO:0004636
Keywords
Ligand & Biological process : ATP-binding; Amino-acid biosynthesis; Complete proteome; Cytoplasm; Histidine biosynthesis; Hydrolase; Multifunctional enzyme; Nucleotide-binding
General annotation
Pathway : Amino-acid biosynthesis; L-histidine biosynthesis; L-histidine from 5-phospho-alpha-D-ribose 1-diphosphate: step 2/9. Amino-acid biosynthesis; L-histidine biosynthesis; L-histidine from 5-phospho-alpha-D-ribose 1-diphosphate: step 3/9.
Subcellular location : Cytoplasm.
Protein sequence
Length : 237 residues
>E1XAC9|E1XAC9_HAEI1 Haemophilus influenzae 10810
MNITKIDWQKVNGLLPVIIQNISTREVLMLGYMNEEALTKTIKERKVTFFSRTKQRLWTK
GEISGNFLNVEEMSLDCDNDTLLILVDPIGATCHTGEYSCFHQFTSPQSENKKQQFANWA
WFIKLEQHLKEKKNADPSNSYTATLHAKGTKKIAQKVGEEGVETALAAVAQDKAEVISEA
TDLVYHLTVLLHNQDLQWYEIIAKLQERHQGIGLHPEGGNK