HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAA4

Names and origin
Entry : E1XAA4 (unreviewed)
Entry name : E1XAA4_HAEI1
Protein names : Fragment of virulence-associated protein d
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_05800
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 49 residues
>E1XAA4|E1XAA4_HAEI1 Haemophilus influenzae 10810
MNEDMANLFQAMNALKQLAWISQSVRDIRAFRIEQWSDFTDFIRN