HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA78

Names and origin
Entry : E1XA78 (unreviewed)
Entry name : E1XA78_HAEI1
Protein names : Preprotein translocase membrane subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_05540
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; protein secretion
GO identifier : GO:0015450; GO:0016021; GO:0009306
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 121 residues
>E1XA78|E1XA78_HAEI1 Haemophilus influenzae 10810
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA
TAFFVIALVLGNMNSHKGNVQKGTFDDLSQAAEQVQQQQAAPAKDNKNSDIPQ