HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA75

Names and origin
Entry : E1XA75 (unreviewed)
Entry name : E1XA75_HAEI1
Protein names : Nucleoid-associated protein HIB_05510
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_05510
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; bacterial nucleoid; cytoplasm
GO identifier : GO:0003677; GO:0043590; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to YbaB/EbfC family
Subcellular location : Cytoplasm › nucleoid.
Protein sequence
Length : 117 residues
>E1XA75|E1XA75_HAEI1 Haemophilus influenzae 10810
MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPS
LMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF