HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA63

Names and origin
Entry : E1XA63 (unreviewed)
Entry name : E1XA63_HAEI1
Protein names : HU, DNA-binding transcriptional regulator, alpha subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_05390
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; chromosome condensation
GO identifier : GO:0003677; GO:0030261
Keywords
Ligand & Biological process : Complete proteome; DNA condensation; DNA-binding
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 98 residues
>E1XA63|E1XA63_HAEI1 Haemophilus influenzae 10810
MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKEGEPVQLIGFGTFKVNERAARTG
RNPQTGAEIQIAASKVPAFVSGKALKDAIK