HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA61

Names and origin
Entry : E1XA61 (unreviewed)
Entry name : E1XA61_HAEI1
Protein names : Disulfide bond formation protein B (Disulfide oxidoreductase)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : dsbB
ORF names : HIB_05370
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron carrier activity; integral to membrane; isomerase activity; plasma membrane; protein disulfide oxidoreductase activity
GO identifier : GO:0009055; GO:0016021; GO:0016853; GO:0005886; GO:0015035
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Chaperone; Complete proteome; Disulfide bond; Electron transport; Isomerase; Membrane; Oxidoreductase; Redox-active center; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to DsbB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 189 residues
>E1XA61|E1XA61_HAEI1 Haemophilus influenzae 10810
MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII
ALLQPRTFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN