HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA46

Names and origin
Entry : E1XA46 (unreviewed)
Entry name : E1XA46_HAEI1
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : hfq
ORF names : HIB_05220
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003723; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Protein sequence
Length : 99 residues
>E1XA46|E1XA46_HAEI1 Haemophilus influenzae 10810
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTAPTEAVENVETQAE