HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA16

Names and origin
Entry : E1XA16 (unreviewed)
Entry name : E1XA16_HAEI1
Protein names : Peptidoglycan-associated outer membrane lipoprotein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04920
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; integral to membrane; plasma membrane
GO identifier : GO:0009279; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Lipoprotein; Membrane
General annotation
Sequence similarities : Belongs to OmpA family
Protein sequence
Length : 165 residues
>E1XA16|E1XA16_HAEI1 Haemophilus influenzae 10810
MNKFVKSLLVAGSVAALAACSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDI
TGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDA
GKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY