HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA14

Names and origin
Entry : E1XA14 (unreviewed)
Entry name : E1XA14_HAEI1
Protein names : DNA-binding transcriptional repressor
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04900
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; double-stranded DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0051537; GO:0003690; GO:0046872; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : 2Fe-2S; Activator; Complete proteome; DNA-binding; Iron; Iron-sulfur; Metal-binding; Repressor; Transcription; Transcription regulation
Protein sequence
Length : 162 residues
>E1XA14|E1XA14_HAEI1 Haemophilus influenzae 10810
MKLTSKGRYAVTAVLDIALNADGGPVSLADISERQHISLSYLEQLFAKLRKDGLVKSVRG
PGGGYQLGLPSEQISVGMIIAAVNENIHVTKCLGRENCKNGVECLTHKLWEDLSLRIESF
LNEITLAELVNKRNVKRQSHRDFNNLLVNQ