HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA11

Names and origin
Entry : E1XA11 (unreviewed)
Entry name : E1XA11_HAEI1
Protein names : FeS cluster assembly protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04870
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier : GO:0005506; GO:0016226; GO:0051536; GO:0005198
Keywords
Ligand & Biological process : Complete proteome; Iron; Metal-binding
Protein sequence
Length : 115 residues
>E1XA11|E1XA11_HAEI1 Haemophilus influenzae 10810
MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQHGV
NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV