HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XA07

Names and origin
Entry : E1XA07 (unreviewed)
Entry name : E1XA07_HAEI1
Protein names : [2Fe-2S] ferredoxin
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04830
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : Complete proteome; Iron; Iron-sulfur; Metal-binding
Protein sequence
Length : 121 residues
>E1XA07|E1XA07_HAEI1 Haemophilus influenzae 10810
MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFD
SLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYNLNHANEAAH