HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9Y5

Names and origin
Entry : E1X9Y5 (unreviewed)
Entry name : E1X9Y5_HAEI1
Protein names : Periplasmic nitrate reductase, electron transfer subunit (Diheme cytochrome c NapB)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04610
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : metal ion binding; oxidation-reduction process; periplasmic space
GO identifier : GO:0046872; GO:0055114; GO:0042597
Keywords
Ligand & Biological process : Complete proteome; Electron transport; Heme; Iron; Metal-binding; Periplasm; Transport
General annotation
Sequence similarities : Belongs to NapB family
Subcellular location : Periplasm.
Protein sequence
Length : 159 residues
>E1X9Y5|E1X9Y5_HAEI1 Haemophilus influenzae 10810
MTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFHNAPRQGELPALNYVN
QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVGSSSSPRRYF
CLQCHVSQANVDPIVPNDFKPMKGYGN