HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E1X9X5

Names and origin

Entry	:	E1X9X5 (unreviewed)
Entry name	:	E1X9X5_HAEI1
Protein names	:	Regulatory protein P-II for glutamine synthetase
Organism	:	Haemophilus influenzae 10810
Organism ID	:	862964
ORF names	:	HIB_04510

History

Date of creation	:	2010-11-30
Date of modification	:	2013-10-16
Date of sequence modification	:	2010-11-30

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier	:	GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>E1X9X5|E1X9X5_HAEI1 Haemophilus influenzae 10810
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYHVERAIRIRTGEENEDAI