HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9X3

Names and origin
Entry : E1X9X3 (unreviewed)
Entry name : E1X9X3_HAEI1
Protein names : Diacylglycerol kinase
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04490
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : diacylglycerol kinase activity; membrane; phospholipid biosynthetic process
GO identifier : GO:0004143; GO:0016020; GO:0008654
Keywords
Ligand & Biological process : Complete proteome; Kinase; Transferase
Protein sequence
Length : 126 residues
>E1X9X3|E1X9X3_HAEI1 Haemophilus influenzae 10810
MYKTTGLTHLINSTKYSLQGLKSAFKNETAFRHECFLACILIPLTFFLGETKIEIILMIS
SVLLVMALELLNSAVEAVVDRIGTERHELSGRAKDQGSASVFIALCIVGIVWGGILFF