HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9U8

Names and origin
Entry : E1X9U8 (unreviewed)
Entry name : E1X9U8_HAEI1
Protein names : Putative Holliday junction resolvase (EC 3.1.-.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04240
EC number : 3.1.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA recombination; DNA repair; cytoplasm; nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0006310; GO:0006281; GO:0005737; GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA damage; DNA recombination; DNA repair; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to YqgF HJR family
Subcellular location : Cytoplasm.
Protein sequence
Length : 151 residues
>E1X9U8|E1X9U8_HAEI1 Haemophilus influenzae 10810
MGITALAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAIEKCLKEWKPDVVIVG
LPLNMDGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGK
IDGVSACLILESWFEYAEY