HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9T6

Names and origin
Entry : E1X9T6 (unreviewed)
Entry name : E1X9T6_HAEI1
Protein names : DNA-binding transcriptional activator of copper-responsive regulon genes
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04120
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA binding; copper ion binding; nucleotide binding; positive regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity
GO identifier : GO:0003677; GO:0005507; GO:0000166; GO:0045893; GO:0003700
Keywords
Ligand & Biological process : Complete proteome; DNA-binding
General annotation
Domains : HTH merR-type DNA-binding domain (1)
Protein sequence
Length : 140 residues
>E1X9T6|E1X9T6_HAEI1 Haemophilus influenzae 10810
MNISEAAKLVGLSTKQIRDYEKIGLIKPAVRSLSGYRNYGESDLERLHFIRHSRNVGFSL
HQIAQLLALQDNPKRSCREVKVLTAQHIATLNQQIEQLQKMVQKLQHWHDSCQGNDNPEC
LILNGLNG