HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9T5

Names and origin
Entry : E1X9T5 (unreviewed)
Entry name : E1X9T5_HAEI1
Protein names : Uncharacterized protein containing Heavy-metal-associated domain
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_04110
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 76 residues
>E1X9T5|E1X9T5_HAEI1 Haemophilus influenzae 10810
MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKSNITFDENRVNVAQLIEVIE
DAGFDATE