HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9J9

Names and origin
Entry : E1X9J9 (unreviewed)
Entry name : E1X9J9_HAEI1
Protein names : Bifunctional dihydroneopterin aldolase/dihydroneopterin triphosphate 2'-epimerase
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_03240
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : dihydroneopterin aldolase activity; folic acid-containing compound metabolic process
GO identifier : GO:0004150; GO:0006760
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 126 residues
>E1X9J9|E1X9J9_HAEI1 Haemophilus influenzae 10810
MDRVFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWDCKQAAETDDVAYCLNYAEVSQAI
IDYVESKPFLLIERVAYEVADLLESRYQLQGLKIKLSKPKAVAQARNVGVLIVRGCLK