HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9J1

Names and origin
Entry : E1X9J1 (unreviewed)
Entry name : E1X9J1_HAEI1
Protein names : Cold shock protein associated with 30S ribosomal subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_03160
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : primary metabolic process
GO identifier : GO:0044238
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 115 residues
>E1X9J1|E1X9J1_HAEI1 Haemophilus influenzae 10810
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFTVEASIGTPLGN
LLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRANERLKDSFEN