HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9I7

Names and origin
Entry : E1X9I7 (unreviewed)
Entry name : E1X9I7_HAEI1
Protein names : Transport protein ExbB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_03120
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; protein transporter activity
GO identifier : GO:0016021; GO:0008565
Keywords
Ligand & Biological process : Complete proteome; Membrane; Protein transport; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ExbB/tolQ family
Subcellular location : Membrane; Multi-pass membrane protein.
Protein sequence
Length : 162 residues
>E1X9I7|E1X9I7_HAEI1 Haemophilus influenzae 10810
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNM
TVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGILVAI
PSMVFYNGLGRKVEVNRLKWKVLSEQKDKE