HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9I6

Names and origin
Entry : E1X9I6 (unreviewed)
Entry name : E1X9I6_HAEI1
Protein names : Transport protein ExbD
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_03110
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; protein transport; transporter activity
GO identifier : GO:0016021; GO:0015031; GO:0005215
Keywords
Ligand & Biological process : Complete proteome; Membrane; Protein transport; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ExbD/tolR family
Subcellular location : Membrane; Single-pass type II membrane protein.
Protein sequence
Length : 159 residues
>E1X9I6|E1X9I6_HAEI1 Haemophilus influenzae 10810
MKKFDEINIIPFIDIMLVLLTVVLITASFISQGKIQVNVPKASTAVAFKSDELAKLLTVT
ADKQLYFNDKPISQEALEAEIAQWNKDQKVTLKIDAEASFQDFVTITDMLSKNEIKNVAI
VSMKDKGKSAGKNSQESTPSQSVPTTP