HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9G2

Names and origin
Entry : E1X9G2 (unreviewed)
Entry name : E1X9G2_HAEI1
Protein names : Mu com-like protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_02870
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 43 residues
>E1X9G2|E1X9G2_HAEI1 Haemophilus influenzae 10810
MQSIKAIRCTFCNKLLAKVGIVGYLEIKCPRCKTVNTTR