HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9F6

Names and origin
Entry : E1X9F6 (unreviewed)
Entry name : E1X9F6_HAEI1
Protein names : Putative transcriptional regulator
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_02810
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : intracellular; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005622; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Domains : HTH asnC-type DNA-binding domains (3)
Protein sequence
Length : 165 residues
>E1X9F6|E1X9F6_HAEI1 Haemophilus influenzae 10810
MQTLDKLDRNILNVLQQDAMIPLKELSEKVNSSVATCQRRVQALTDSGVITKRVAVVSPK
AVGRTISVFVMVEMDNQHSYYQEQFERKMRQEDEVVSCYEISGDYDFMLLLHAKDMESYH
AFTRRVLTGEFHVRTYKSLFVMNFTKADSGIIL