HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9D9

Names and origin
Entry : E1X9D9 (unreviewed)
Entry name : E1X9D9_HAEI1
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_02620
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 39 residues
>E1X9D9|E1X9D9_HAEI1 Haemophilus influenzae 10810
MNYLIMDKTFLEQEILLPQFIIQNIERWFKTHNFV