HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9D6

Names and origin
Entry : E1X9D6 (unreviewed)
Entry name : E1X9D6_HAEI1
Protein names : Shikimate kinase (SK) (EC 2.7.1.71)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : aroK
ORF names : HIB_02590
EC number : 2.7.1.71
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; aromatic amino acid family biosynthetic process; chorismate biosynthetic process; cytoplasm; magnesium ion binding; shikimate kinase activity
GO identifier : GO:0005524; GO:0009073; GO:0009423; GO:0005737; GO:0000287; GO:0004765
Keywords
Ligand & Biological process : ATP-binding; Amino-acid biosynthesis; Aromatic amino acid biosynthesis; Complete proteome; Cytoplasm; Kinase; Magnesium; Metal-binding; Nucleotide-binding; Transferase
General annotation
Pathway : Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 5/7.
Sequence similarities : Belongs to Shikimate kinase family
Subcellular location : Cytoplasm.
Protein sequence
Length : 192 residues
>E1X9D6|E1X9D6_HAEI1 Haemophilus influenzae 10810
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMDFIDSDAVIEERTGADISWIFDLEGEDGFR
KREERIINELTQMQGIVLSTGGGAVLSKENRNYLSARGIVIYLETTVEKQFQRTQRDKKR
PLLQDAENPRQVLEDLAKIRNPLYEEIADITLPTDEQNAKIMVNQIVDLIDNMNGLNGAL