HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9D2

Names and origin
Entry : E1X9D2 (unreviewed)
Entry name : E1X9D2_HAEI1
Protein names : Ribosome maturation factor RimM
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rimM
ORF names : HIB_02550
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA processing; ribosomal small subunit biogenesis; ribosome; ribosome binding
GO identifier : GO:0006364; GO:0042274; GO:0005840; GO:0043022
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm; Ribosome biogenesis
General annotation
Domains : PRC barrel domain (1)
Sequence similarities : Belongs to RimM family
Subcellular location : Cytoplasm.
Protein sequence
Length : 187 residues
>E1X9D2|E1X9D2_HAEI1 Haemophilus influenzae 10810
MEQQHIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHN
HEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTV
TEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGF