HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X9B6

Names and origin
Entry : E1X9B6 (unreviewed)
Entry name : E1X9B6_HAEI1
Protein names : Sec-independent protein translocase protein TatB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : tatB
ORF names : HIB_02390
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : TAT protein transport complex; integral to plasma membrane; protein secretion; protein transmembrane transporter activity; protein transport by the Tat complex
GO identifier : GO:0033281; GO:0005887; GO:0009306; GO:0008320; GO:0043953
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to TatB family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Protein sequence
Length : 198 residues
>E1X9B6|E1X9B6_HAEI1 Haemophilus influenzae 10810
MFDIGFSELILLMVLGLVVLGPKRLPIAIRTVMDWVKTIRGLAANVQNELKQELKLQELQ
DSIKKAESLNLQALSPELSKTVEELKAQADKMKAELEDKAAQAGTTVEEQIKEIKSAAEN
AEKSQNAISVEEAAEAEKTPTDLTALETHEKVELNTHLSSYYPPDDIEIAPASKSQSSKT
KS