HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X999

Names and origin
Entry : E1X999 (unreviewed)
Entry name : E1X999_HAEI1
Protein names : Na(+)-translocating NADH-quinone reductase subunit F (Na(+)-NQR subunit F) (Na(+)-translocating NQR subunit F) (EC 1.6.5.-) (NQR complex subunit F) (NQR-1 subunit F)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : nqrF
ORF names : HIB_02220
EC number : 1.6.5.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; Gram-negative-bacterium-type cell wall; electron carrier activity; integral to membrane; metal ion binding; oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor; plasma membrane; sodium ion
GO identifier : GO:0051537; GO:0009276; GO:0009055; GO:0016021; GO:0046872; GO:0016655; GO:0005886; GO:0006814
Keywords
Ligand & Biological process : 2Fe-2S; Cell inner membrane; Cell membrane; Complete proteome; FAD; Flavoprotein; Ion transport; Iron; Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Sodium; Sodium transport; Transmembrane; Transmembrane helix; Transport; Ubiquinone
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1); FAD-binding FR-type domain (1)
Sequence similarities : Belongs to NqrF family
Subcellular location : Cell inner membrane.
Protein sequence
Length : 439 residues
>E1X999|E1X999_HAEI1 Haemophilus influenzae 10810
MSDSVILALGIAAFTVIVLVLVAIILFAKSKLVDSGDITIDINDDPEKAITLPAGGKLLG
ALASKGIFVSSACGGGGSCGQCIVKVKNGGGEILPTELSHINKREAKEGYRLACQVNVKG
NMEVELPEEIFGVKKWECTVISNDNKATFIKELKLAIPEGEEVPFRAGGYIQIEAEPHVV
NYKDFDIPEEYHEDWDKYDLWRYVSKVDEHIIRAYSMASYPEEKGIIMLNVRIATPPPRQ
PDAPPGQMSSYIWSLKAGDKVTISGPFGEFFAKETDAEMVFIGGGAGMAPMRSHIFDQLK
RLHSKRKMSFWYGARSKREIFYQEDFDQLQAENPNFVWHVALSDALPEDNWTGYTGFIHN
VLYENYLKNHEAPEDCEYYMCGPPVMNAAVIKMLKDLGVEDENILLDDFGG