HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X996

Names and origin
Entry : E1X996 (unreviewed)
Entry name : E1X996_HAEI1
Protein names : Na(+)-translocating NADH-quinone reductase subunit C (Na(+)-NQR subunit C) (Na(+)-translocating NQR subunit C) (EC 1.6.5.-) (NQR complex subunit C) (NQR-1 subunit C)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : nqrC
ORF names : HIB_02190
EC number : 1.6.5.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : FMN binding; Gram-negative-bacterium-type cell wall; integral to membrane; oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor; plasma membrane; sodium ion transport
GO identifier : GO:0010181; GO:0009276; GO:0016021; GO:0016655; GO:0005886; GO:0006814
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; FMN; Flavoprotein; Ion transport; Membrane; NAD; Oxidoreductase; Phosphoprotein; Sodium; Sodium transport; Transmembrane; Transmembrane helix; Transport; Ubiquinone
General annotation
Sequence similarities : Belongs to NqrC family
Subcellular location : Cell inner membrane.
Protein sequence
Length : 264 residues
>E1X996|E1X996_HAEI1 Haemophilus influenzae 10810
MAKFNKDSVGGTILVVLLLSLVCSIIVAGSAVMLKPAQEEQKLLDKQKNILNVAGLLQEN
TNVKETYAKFIEPRFVDLATGEYTQQADDSQQAIPADADKARIRSRSKTTEIYLVKDEQG
QTQQVILPIYGTGLWSVMYGLVSVQPDGNTINGITYYQHGETPGLGGEIENPNWASLFKG
KKLFDEQHQPAIRIVKGQAPQDEHSIDGLSGATLTGNGVQGTFNYWFSKDGFGPYLEKLH
SGAN