HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X993

Names and origin
Entry : E1X993 (unreviewed)
Entry name : E1X993_HAEI1
Protein names : Regulator of penicillin binding proteins and beta lactamase transcription (Morphogene)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_02160
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to BolA/yrbA family
Protein sequence
Length : 111 residues
>E1X993|E1X993_HAEI1 Haemophilus influenzae 10810
MSIQQIIEQKIQKEFQPHFLAIENESHLHHSNRGSESHFKCVIVSAAFKNIRKVQRHQRI
YQLLNEELNHSIHALALHLFTPEEWKAQNETVPHSTKCAGIGR