HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X984

Names and origin
Entry : E1X984 (unreviewed)
Entry name : E1X984_HAEI1
Protein names : Acyl carrier protein (ACP)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : acpP
ORF names : HIB_02070
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process; cytoplasm
GO identifier : GO:0000036; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Phosphopantetheine
General annotation
Domains : Acyl carrier domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Subcellular location : Cytoplasm.
Protein sequence
Length : 84 residues
>E1X984|E1X984_HAEI1 Haemophilus influenzae 10810
MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KITTVQSAIDYVQNNQ