HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8T2

Names and origin
Entry : E1X8T2 (unreviewed)
Entry name : E1X8T2_HAEI1
Protein names : RNA polymerase-binding transcription factor DksA
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : dksA
ORF names : HIB_00550
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of gene expression; zinc ion binding
GO identifier : GO:0003677; GO:0005737; GO:0010468; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding; Metal-binding; Zinc; Zinc-finger
General annotation
Domains : DksA C4-type zinc finger (1)
Sequence similarities : Belongs to DksA family
Subcellular location : Cytoplasm.
Protein sequence
Length : 157 residues
>E1X8T2|E1X8T2_HAEI1 Haemophilus influenzae 10810
MSKASLSLLDLAGVKPYQMKKDEEYMNEEQILHFRKILNAWHEQIVEEASRTVAHMQDEV
TNFPDPADRATQEEEFSLELRNRDRERKLMKKIEATLKKLDTDDFGYCDCCGEEIGIRRL
EARPTADLCIDCKTLAEIREKQVAG