HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8S4

Names and origin
Entry : E1X8S4 (unreviewed)
Entry name : E1X8S4_HAEI1
Protein names : Conserved hypothetical transposase-like protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_00470
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA integration; nucleic acid binding
GO identifier : GO:0015074; GO:0003676
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 125 residues
>E1X8S4|E1X8S4_HAEI1 Haemophilus influenzae 10810
MKSNNGNYPNAKGLNKACGVILHSDQGWQYQMVAYRRILAEHGIIQSMSRKGNCLDNAAM
ESFFGRLKTECFYDREFNCREEIVDAVRDYLDYYNHRRIQLKLKGLSPIQYRKQSFK