HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8R2

Names and origin
Entry : E1X8R2 (unreviewed)
Entry name : E1X8R2_HAEI1
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rsfS
ORF names : HIB_00340
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; mature ribosome assembly; negative regulation of ribosome biogenesis; negative regulation of translation
GO identifier : GO:0005737; GO:0042256; GO:0090071; GO:0017148
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Protein sequence
Length : 110 residues
>E1X8R2|E1X8R2_HAEI1 Haemophilus influenzae 10810
MALVEFLMETLEGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQRDAREMYQLEKLWA