HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8Q2

Names and origin
Entry : E1X8Q2 (unreviewed)
Entry name : E1X8Q2_HAEI1
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : citD
ORF names : HIB_00240
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; lyase activity
GO identifier : GO:0005737; GO:0016829
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Lyase; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Protein sequence
Length : 103 residues
>E1X8Q2|E1X8Q2_HAEI1 Haemophilus influenzae 10810
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKAAAMRATDETINWEAVL