HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8K0

Names and origin
Entry : E1X8K0 (unreviewed)
Entry name : E1X8K0_HAEI1
Protein names : Phosphohistidinoprotein-hexose phosphotransferase component of PTS system (Hpr)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_18910
History
Date of creation : 2010-11-30
Date of modification : 2013-11-13
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; phosphoenolpyruvate-dependent sugar phosphotransferase system; protein serine/threonine kinase activity; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0009401; GO:0004674; GO:0005351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Kinase; Phosphotransferase system; Serine/threonine-protein kinase; Transferase
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 93 residues
>E1X8K0|E1X8K0_HAEI1 Haemophilus influenzae 10810
MYSKDVEIIAPNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLALTQGTT
LTISADGEDEQQAVEYLVALIPTLE