HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8H3

Names and origin
Entry : E1X8H3 (unreviewed)
Entry name : E1X8H3_HAEI1
Protein names : Electron transport complex protein RnfG
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rnfG
ORF names : HIB_18640
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : FMN binding; electron carrier activity; electron transport chain; integral to membrane; plasma membrane
GO identifier : GO:0010181; GO:0009055; GO:0022900; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Electron transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to RnfG family
Subcellular location : Cell inner membrane.
Protein sequence
Length : 223 residues
>E1X8H3|E1X8H3_HAEI1 Haemophilus influenzae 10810
MGTVKITSRYGILLGFIALLCTAISAGIYFLTKDKIDAVIAAQQRGLLLQVIPQDYFNNN
LLESAVIPQDKNFVGIQKIYFAKKDGNISAYAYETTAPDGYSGDIRLLVGLDPKGEVLGV
RVIEHHETPGLGDKIERRISNWILGFTNQSINEHNLSEWAVKKDGGKFDQFSGATITPRA
VVNQTKRSALIMLNNQALLQQLSTQVK