HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8H0

Names and origin
Entry : E1X8H0 (unreviewed)
Entry name : E1X8H0_HAEI1
Protein names : Electron transport complex protein RnfB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rnfB
ORF names : HIB_18610
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; electron transport chain; metal ion binding; plasma membrane
GO identifier : GO:0051537; GO:0051539; GO:0009055; GO:0022900; GO:0046872; GO:0005886
Keywords
Ligand & Biological process : 2Fe-2S; 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Electron transport; Iron; Iron-sulfur; Membrane; Metal-binding; Repeat; Transport
General annotation
Domains : 4Fe-4S ferredoxin-type domains (2)
Sequence similarities : Belongs to 4Fe4S bacterial-type ferredoxin family, RnfB subfamily
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 209 residues
>E1X8H0|E1X8H0_HAEI1 Haemophilus influenzae 10810
MTFLFIVITLLALIFGAILGFASIKLKVEADPVVEKIDAILPQSQCGQCGYPGCKPYAEA
ICNGDEITKCIPGGQTTIVKIAEILGVDVPTMEGVEEPIEKVAFIDENMCIGCTKCIQAC
PVDAIIGTNKAMHTIIPDLCTGCELCVAPCPTDCILMIPVKKNIDNWDWKFDAKLVIPVM
NVDGSEKKLVVGE