HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8G1

Names and origin
Entry : E1X8G1 (unreviewed)
Entry name : E1X8G1_HAEI1
Protein names : Molybdopterin synthase, small subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_18510
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : Mo-molybdopterin cofactor biosynthetic process
GO identifier : GO:0006777
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 89 residues
>E1X8G1|E1X8G1_HAEI1 Haemophilus influenzae 10810
MLNVLFFAQTRELIGIDAIQLEDDFATAEAVREHLTQKGDKWALALEKGKLLVAINQTLM
PLESAVKNGDEIAFFPPVTGG