HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8E5

Names and origin
Entry : E1X8E5 (unreviewed)
Entry name : E1X8E5_HAEI1
Protein names : UPF0102 protein HIB_18350
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_18350
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0102 family
Protein sequence
Length : 127 residues
>E1X8E5|E1X8E5_HAEI1 Haemophilus influenzae 10810
MFSLKRRQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD