HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8D9

Names and origin
Entry : E1X8D9 (unreviewed)
Entry name : E1X8D9_HAEI1
Protein names : Genome
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_18290
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : phosphorelay signal transduction system; signal transducer activity
GO identifier : GO:0000160; GO:0004871
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 100 residues
>E1X8D9|E1X8D9_HAEI1 Haemophilus influenzae 10810
MDGILRKLISMKDLHHCLQKFFVDERESILEMNDNKLSEQFDLALIETHGKSKILKNLSL
FKQTMPNYLTQLSKDNMKETENTVHKIKRVAA