HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8D7

Names and origin
Entry : E1X8D7 (unreviewed)
Entry name : E1X8D7_HAEI1
Protein names : Glutamine amidotransferase subunit PdxT (EC 2.6.-.-) (Glutamine amidotransferase glutaminase subunit PdxT)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : pdxT
ORF names : HIB_18270
EC number : 2.6.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : glutamine catabolic process; pyridoxal phosphate biosynthetic process; transferase activity
GO identifier : GO:0006543; GO:0042823; GO:0016740
Keywords
Ligand & Biological process : Complete proteome; Glutamine amidotransferase; Pyridoxal phosphate; Transferase
General annotation
Pathway : Cofactor biosynthesis; pyridoxal 5'-phosphate biosynthesis.
Sequence similarities : Belongs to Glutamine amidotransferase PdxT/SNO family
Protein sequence
Length : 208 residues
>E1X8D7|E1X8D7_HAEI1 Haemophilus influenzae 10810
MKIGILALQGAFAEHAQMLEKLGIESVELRNLKNFQQHYSDLSGLILPGGESTAIGKLLR
ELYMLEPIKQAISSGFPVFGTCAGLILLAKEITSQKESHFGTMDIVVERNAYGRQLGSFY
TEADCKGVGKIPMTFIRGPIISSVGKKVNILATVNNKIVAAQEKNMLVTSFHPELTNNLS
LHKYFIDICKVA