HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X8D5

Names and origin
Entry : E1X8D5 (unreviewed)
Entry name : E1X8D5_HAEI1
Protein names : Genome
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_18250
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 35 residues
>E1X8D5|E1X8D5_HAEI1 Haemophilus influenzae 10810
MGMIITVDGPSGAGKGTLCYALAEKLGYAFY