HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X897

Names and origin
Entry : E1X897 (unreviewed)
Entry name : E1X897_HAEI1
Protein names : Outer-membrane lipoprotein LolB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : lolB
ORF names : HIB_17870
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; plasma membrane; protein transporter activity
GO identifier : GO:0009279; GO:0005886; GO:0008565
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Chaperone; Complete proteome; Lipoprotein; Membrane; Palmitate; Protein transport; Signal; Transport
General annotation
Sequence similarities : Belongs to LolB family
Subcellular location : Cell outer membrane; Lipid-anchor.
Protein sequence
Length : 222 residues
>E1X897|E1X897_HAEI1 Haemophilus influenzae 10810
MKTFKFLTALFATAILTACTLDMERPTNVQYIDKTDVIWQQHLQKIQKIQSYQAKGQIGY
ISPTERFSSRFEWQYQNPKSYTLKLYSLISKSTLWIQMHQSGMTISDNNGNQQYAANAKQ
LLQEIIGMDIPLEHLVYWLKGQPAINADYQVGTNHLLGAFTYHVDGSQWTADYLTYHSNN
SMPENILLKNDSTKQTLKIRIDEWIY