HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X886

Names and origin
Entry : E1X886 (unreviewed)
Entry name : E1X886_HAEI1
Protein names : DNA-binding transcriptional dual regulator, leucine-binding
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_17760
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : intracellular; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005622; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Domains : HTH asnC-type DNA-binding domains (3)
Protein sequence
Length : 178 residues
>E1X886|E1X886_HAEI1 Haemophilus influenzae 10810
MCKEIKKMEKKRNKALDAIDIKILNELQRNGKISNIDLSKKVGLSPTPCLERVKRLEKQG
VIMGYRALLNPELLDAPLLVIVEITLVRGKPDVFEEFNAAIQALEEIQECHLVSGDFDYL
LKTRVADMAEYRKLLGTTLLRLPGVNDTRTYVVMEEVKQTNFLVLK