HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X817

Names and origin
Entry : E1X817 (unreviewed)
Entry name : E1X817_HAEI1
Protein names : Outer membrane-specific lipoprotein transporter subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_17070
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity; lipoprotein transporter activity; plasma membrane
GO identifier : GO:0005524; GO:0006200; GO:0016887; GO:0042954; GO:0005886
Keywords
Ligand & Biological process : ATP-binding; Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Lipoprotein; Membrane; Nucleotide-binding; Transport
General annotation
Sequence similarities : Belongs to ABC transporter superfamily
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 243 residues
>E1X817|E1X817_HAEI1 Haemophilus influenzae 10810
MNNYLLKCENINKFYQEGENQTQVLKGVSFSMEPAELVAIVGSSGSGKSTLLHTLGGLDQ
PSSGEVFINGQSLQKASANELAALRNRYLGFVYQFHHLMADFTALENVMMPMLIGHQNKT
EAKDRAEKMLSAVGLSHRITHRPSALSGGERQRVAIARALVNNPSLVLADEPTGNLDHKT
TESIFELIQQLNQEQNIAFLLVTHDMGLAEKLSRRLVMQDGLLKEGA