HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X803

Names and origin
Entry : E1X803 (unreviewed)
Entry name : E1X803_HAEI1
Protein names : Glutaredoxin 1, redox coenzyme for ribonucleotide reductase (RNR1a)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_16920
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 95 residues
>E1X803|E1X803_HAEI1 Haemophilus influenzae 10810
MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKEQFGIVA