HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7W3

Names and origin
Entry : E1X7W3 (unreviewed)
Entry name : E1X7W3_HAEI1
Protein names : 30S ribosomal protein S9
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rpsI
ORF names : HIB_16500
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein S9P family
Protein sequence
Length : 142 residues
>E1X7W3|E1X7W3_HAEI1 Haemophilus influenzae 10810
MAENQNYGTGRRKSSSARVFIKPGSGKITINQRELDVYFGRETARMVVRQPLELVELTDK
LDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARRVERKKVGLHK
ARRRPQYSKR