HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7V7

Names and origin
Entry : E1X7V7 (unreviewed)
Entry name : E1X7V7_HAEI1
Protein names : Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : xseB
ORF names : HIB_16440
EC number : 3.1.11.6
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA catabolic process; cytoplasm; exodeoxyribonuclease VII activity; exodeoxyribonuclease VII complex; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0006308; GO:0005737; GO:0008855; GO:0009318; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Exonuclease; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to XseB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 92 residues
>E1X7V7|E1X7V7_HAEI1 Haemophilus influenzae 10810
MARKPASSQDFETTLAKLENIVTHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAEQRI
QILLQKTEDAPLNDYKGNDYEGNA